Protein coding transcript 221586

• Transcript: Ll_transcript_9931
• CDS coordinates: 994-1377 (+)
• Peptide sequence: MDNAHTRRGKPCWFRVPKVGLIAANDALLLRGHTARILKNHFRRKPYYADLVDLFNEIEFQTISGQMLDMTATLEGEKDLSKYTLSLHCSIAEYKTSYYTFYLPVSVVSSHMLSCLFNLGFFLALIP*
• ORF Type: complete

Annotations of Ll_transcript_9931

• Blastp: Farnesyl pyrophosphate synthase 1 from Lupinus with 77.36% of identity
• Blastx: Farnesyl pyrophosphate synthase 1 from Lupinus with 73.56% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440029.1)
• Pfam: Polyprenyl synthetase (PF00348.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;