Transcript | Ll_transcript_9932 |
---|---|
CDS coordinates | 1-522 (+) |
Peptide sequence | FSSMGRTGILYLIFHNHSTNPKMMDYNVFGGKLNRGLSVIDSYTLLKDGEELNDDEIFLASTLAWCIEWLQACFVVVDDIMDNAHTRRGKPCWFRVPKVGLIAANDALLLRGHTARILKNHFRRKPYYADLVDLFNEIEFQTISGQMLDMTATLEGEKDLSKYTLSLHCSIAEY |
ORF Type | internal |
Blastp | Farnesyl pyrophosphate synthase 1 from Lupinus with 79.74% of identity |
---|---|
Blastx | Farnesyl pyrophosphate synthase 1 from Lupinus with 79.74% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440029.1) |
Pfam | Polyprenyl synthetase (PF00348.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer