Protein coding transcript 221588

• Transcript: Ll_transcript_9904
• CDS coordinates: 68-409 (+)
• Peptide sequence: MADLDTFFYVYSILKSELLHDPLFKFSNDSRQWVERMMDYNVFGGKLNRGLSVIDSYTLLKDGEELNDDEIFLASTLAWCIEWLQACFVVVDDIMDNAHTRRGKPCWFRVPKV*
• ORF Type: complete

Annotations of Ll_transcript_9904

• Blastp: Farnesyl pyrophosphate synthase 1 from Lupinus with 81.58% of identity
• Blastx: Farnesyl pyrophosphate synthase 1 from Lupinus with 81.58% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418356.1)
• Pfam: Polyprenyl synthetase (PF00348.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;