Protein coding transcript 221590

• Transcript: Ll_transcript_9912
• CDS coordinates: 994-1497 (+)
• Peptide sequence: MDNAHTRRGKPCWFRVPKVGLIAANDALLLRGHTARILKNHFRRKPYYADLVDLFNEIEFQTISGQMLDMTATLEGEKDLSKYTLSLHCSIAEYKTSYYTFYLPVACALLMLGDNLDNHINVKNILVEMGTFYQAQDDYLDCFGDPEIIGKIGTDIEDFKCSWLVVKA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_9912

• Blastp: Farnesyl pyrophosphate synthase 1 from Lupinus with 80.95% of identity
• Blastx: Farnesyl pyrophosphate synthase 1 from Lupinus with 77.12% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418356.1)
• Pfam: Polyprenyl synthetase (PF00348.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;