Protein coding transcript 221600

• Transcript: Ll_transcript_8707
• CDS coordinates: 326-778 (+)
• Peptide sequence: MYMMEVDRVLRPGGYWVLSGPPINWEVNYKAWQRPKEELEEEQRKIEEVAKQLCWEKRSQKAEIAIWQKTVDTESCRSRQDDSSVKFCETSDADDVWYKKMEDCITPSPKASSKGLKPFPSRLYAIPPRIASGSVPGVSSDTYQDDNKKWK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_8707

• Blastp: Probable methyltransferase PMT2 from Arabidopsis with 68.79% of identity
• Blastx: Probable methyltransferase PMT2 from Arabidopsis with 55.85% of identity
• Eggnog: Methyltransferase(ENOG410YD4N)
• Kegg: Link to kegg annotations (AT1G26850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014634839.1)
• Pfam: Putative S-adenosyl-L-methionine-dependent methyltransferase (PF03141.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;