Protein coding transcript 221673

• Transcript: Ll_transcript_11218
• CDS coordinates: 473-1096 (+)
• Peptide sequence: MGMPRFGRAKNNGESSSNIYVANCGPGVGISHDDIASVFSKFGDINGVYAADDTGTRVIVSYSHHSSAQSALMALDGHTCPQLGGRSLHIRYSVQNSIPKDKMSDSVPVSITASDLGISGIYLVHDFISAEEEEVLLQAVDCRPWNCLSKRRVQHYGYEFCYDTRNVNTRHCLGELPSFVSPLLERISSCPTFKNVENIVLDQVTVC*
• ORF Type: complete

Annotations of Ll_transcript_11218

• Blastp: Alkylated DNA repair protein alkB homolog 8 from Silurana with 28.18% of identity
• Blastx: Alkylated DNA repair protein alkB homolog 8 from Silurana with 38.31% of identity
• Eggnog: Methyltransferase(COG0500)
• Kegg: Link to kegg annotations (550051)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017427384.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;