| Transcript | Ll_transcript_11220 |
|---|---|
| CDS coordinates | 1134-1466 (+) |
| Peptide sequence | MGMPRFGRAKNNGESSSNIYVANCGPGVGISHDDIASVFSKFGDINGVYAADDTGTRVIVSYSHHSSAQSALMALDGHTCPQLGGRSLHIRYSVQNSIPKHQILAFQAFT* |
| ORF Type | complete |
| Blastp | - |
|---|---|
| Blastx | Alkylated DNA repair protein alkB homolog 8 from Silurana with 38.31% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_003534335.1) |
| Pfam | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer