Transcript | Ll_transcript_11229 |
---|---|
CDS coordinates | 1134-1757 (+) |
Peptide sequence | MGMPRFGRAKNNGESSSNIYVANCGPGVGISHDDIASVFSKFGDINGVYAADDTGTRVIVSYSHHSSAQSALMALDGHTCPQLGGRSLHIRYSVQNSIPKDKMSDSVPVSITASDLGISGIYLVHDFISAEEEEVLLQAVDCRPWNCLSKRRVQHYGYEFCYDTRNVNTRHCLGELPSFVSPLLERISSCPTFKNVENIVLDQVTVC* |
ORF Type | complete |
Blastp | Alkylated DNA repair protein alkB homolog 8 from Silurana with 28.18% of identity |
---|---|
Blastx | Alkylated DNA repair protein alkB homolog 8 from Silurana with 40.4% of identity |
Eggnog | Methyltransferase(COG0500) |
Kegg | Link to kegg annotations (550051) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003534335.1) |
Pfam | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer