Protein coding transcript 221684

• Transcript: Ll_transcript_11210
• CDS coordinates: 1134-1643 (+)
• Peptide sequence: MGMPRFGRAKNNGESSSNIYVANCGPGVGISHDDIASVFSKFGDINGVYAADDTGTRVIVSYSHHSSAQSALMALDGHTCPQLGGRSLHIRYSVQNSIPKDKMSDSVPVSITASDLGISGIYLVHDFISAEEEEVLLQAVDCRPWNCLSKRRVQHYGYEFCYDVSFKDY*
• ORF Type: complete

Annotations of Ll_transcript_11210

• Blastp: Alkylated DNA repair protein alkB homolog 8 from Silurana with 27.39% of identity
• Blastx: Alkylated DNA repair protein alkB homolog 8 from Silurana with 27.39% of identity
• Eggnog: Methyltransferase(COG0500)
• Kegg: Link to kegg annotations (550051)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445183.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;