Protein coding transcript 221784

• Transcript: Ll_transcript_11438
• CDS coordinates: 99-419 (+)
• Peptide sequence: MASTVLLRSIIKSSSTTLISSSKRTFSFLAPQIGNHTAKWMQDTSKKSPMELINEVPPIKVDGRIVACEGDTNPALGHPIEYICLDLEAPAVCKYCGLRYVQDHHH*
• ORF Type: complete

Annotations of Ll_transcript_11438

• Blastp: NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial from Arabidopsis with 70.18% of identity
• Blastx: NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial from Arabidopsis with 90.54% of identity
• Eggnog: electron transport chain(ENOG4111W6X)
• Kegg: Link to kegg annotations (AT3G03070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413252.1)
• Pfam: Zinc-finger domain (PF10276.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;