Protein coding transcript 221786

• Transcript: Ll_transcript_11445
• CDS coordinates: 112-729 (+)
• Peptide sequence: MATSLTTPKLSSFSCSATLTLNSLFFPKSLHLSRPSLLSLPATLLSLSHPRRTFAVRAHSQNGADAPPHYDFDLFTIGAGSGGVRASRFAASYGANVAICELPFSTISSDTTGGVGGTCVIRGCVPKKLLVYASKYSHEFEERKWLKFYGPTHEERGSKALSIEWKGLCVRNGFNCSFEEHHQIIIHYTNFIIQENLLFSCSSNR*
• ORF Type: complete

Annotations of Ll_transcript_11445

• Blastp: Glutathione reductase, chloroplastic/mitochondrial from Pisum with 66.25% of identity
• Blastx: Glutathione reductase, chloroplastic/mitochondrial from Pisum with 64.38% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441912.1)
• Pfam: Pyridine nucleotide-disulphide oxidoreductase (PF07992.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;