Transcript | Ll_transcript_9685 |
---|---|
CDS coordinates | 404-1252 (+) |
Peptide sequence | MLAMGCMNIAGSLTSCYVATGSFSRTAVNFSAGCKTSISNIVMGVTVILCLELFTRLLYYTPMAILASIILSALPGLIDINEACYIWKVDKFDFLACAGAFFGVLFKSVETGLLVAVSISFAKILIQSIRPGIEILGRVPRTDAFCDVVQYPMAISTPGILVIRISSGSLCFANANFVRERILKLIKKEEDELNQAAKGRVQAVILDMTNLMNVDTSGILALEELHKRLHTRGIELAMVNPRWLVIHKLKLAHFVEKIGKELVFLTVSEAVDACLASKFSIP* |
ORF Type | complete |
Blastp | Low affinity sulfate transporter 3 from Stylosanthes with 81.49% of identity |
---|---|
Blastx | Low affinity sulfate transporter 3 from Stylosanthes with 82.2% of identity |
Eggnog | - |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0001772) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417897.1) |
Pfam | Sulfate permease family (PF00916.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer