| Transcript | Ll_transcript_9693 |
|---|---|
| CDS coordinates | 824-1216 (+) |
| Peptide sequence | MAISTPGILVIRISSGSLCFANANFVRERILKLIKKEEDELNQAAKGRVQAVILDMTNLMNVDTSGILALEELHKRLHTRGIELAMVNPRWLVIHKLKLAHFVEKIGKELVFLTVSEAVDACLASKFSIP* |
| ORF Type | complete |
| Blastp | Low affinity sulfate transporter 3 from Stylosanthes with 77.52% of identity |
|---|---|
| Blastx | Low affinity sulfate transporter 3 from Stylosanthes with 75.15% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019417897.1) |
| Pfam | STAS domain (PF01740.20) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer