Protein coding transcript 221810

• Transcript: Ll_transcript_9694
• CDS coordinates: 404-1183 (+)
• Peptide sequence: MLAMGCMNIAGSLTSCYVATGSFSRTAVNFSAGCKTSISNIVMGVTVILCLELFTRLLYYTPMAILASIILSALPGLIDINEACYIWKVDKLDFLACLGAFLGVLFASVEIGLIVAVTISFAKILIQAIRPGIEVLGRVPRTEAFCDVTQYPMAISTPGIIVIRISSGSLCFANANFVRERILKWVSEDEDLKESTKGRIQAVILDMTNLMNVDTSGILALEELHKRLLSRGVEVRPPWFYIFGTQILPMTLYVNLVPD*
• ORF Type: complete

Annotations of Ll_transcript_9694

• Blastp: Low affinity sulfate transporter 3 from Stylosanthes with 80.74% of identity
• Blastx: Low affinity sulfate transporter 3 from Stylosanthes with 81.74% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0001772)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454493.1)
• Pfam: Sulfate permease family (PF00916.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;