Transcript | Ll_transcript_9537 |
---|---|
CDS coordinates | 927-1637 (+) |
Peptide sequence | MSDIVLHMILLYVYFSVIEAANGLQAWKMLEDLTNHIDLILTEVAMPGLSGIGLLYKIMSHKTRKNIPVIMMSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSSGSGSESGTQTQKSVKSKSLEKSDNNSGSNDKDDDGSEGLNNGDGSDNGSGTQSSWTKQAVEVDSPEPTFQWDQIAECPDSTCAQVVHSNAEISGDKAVPLAIKESTEQKEQLDENIIKY* |
ORF Type | complete |
Blastp | Two-component response regulator-like APRR7 from Arabidopsis with 66.96% of identity |
---|---|
Blastx | Two-component response regulator-like PRR73 from Oryza sativa with 61.32% of identity |
Eggnog | Transcription factor(COG5641) |
Kegg | Link to kegg annotations (AT5G02810) |
CantataDB | Link to cantataDB annotations (CNT0000796) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427742.1) |
Pfam | Response regulator receiver domain (PF00072.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer