Protein coding transcript 221861

• Transcript: Ll_transcript_9537
• CDS coordinates: 927-1637 (+)
• Peptide sequence: MSDIVLHMILLYVYFSVIEAANGLQAWKMLEDLTNHIDLILTEVAMPGLSGIGLLYKIMSHKTRKNIPVIMMSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSSGSGSESGTQTQKSVKSKSLEKSDNNSGSNDKDDDGSEGLNNGDGSDNGSGTQSSWTKQAVEVDSPEPTFQWDQIAECPDSTCAQVVHSNAEISGDKAVPLAIKESTEQKEQLDENIIKY*
• ORF Type: complete

Annotations of Ll_transcript_9537

• Blastp: Two-component response regulator-like APRR7 from Arabidopsis with 66.96% of identity
• Blastx: Two-component response regulator-like PRR73 from Oryza sativa with 61.32% of identity
• Eggnog: Transcription factor(COG5641)
• Kegg: Link to kegg annotations (AT5G02810)
• CantataDB: Link to cantataDB annotations (CNT0000796)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427742.1)
• Pfam: Response regulator receiver domain (PF00072.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;