Transcript | Ll_transcript_9539 |
---|---|
CDS coordinates | 2465-3427 (+) |
Peptide sequence | MSLSDAIPRTFDSQMHSGEFEALDRRPYSDVEDKGTNNDEELPSLELSLKRLRGVKDAGNIQDERNVLRRSDLSAFSRYNAASNAKKSPTGYVGSNSPHNNSLEVTKKDLSRDIQSNSSGNPPNQNSNGASNNIDMGSTTDNNAFTKSAVIRAPAVVSTTKCLYQSSAFQPLKNNLMCTSQQVVLHDTEDKTAPTLAPPRVDVHKDSATKDFCHHYESHNCLANNMQHQLPPDHRAELFKKMAATAPNFGSSNVVEVAVEGNVGNYSVNRSASGSNNGSNGQNGCGTDFNVGGTNIENNNGFAVNSGSGDGSANRVDQNKI |
ORF Type | 3prime_partial |
Blastp | Two-component response regulator-like PRR73 from Oryza sativa with 37.91% of identity |
---|---|
Blastx | Two-component response regulator-like APRR7 from Arabidopsis with 67.1% of identity |
Eggnog | two component, sigma54 specific, transcriptional regulator, Fis family(COG2204) |
Kegg | Link to kegg annotations (4332464) |
CantataDB | Link to cantataDB annotations (CNT0000796) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427737.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer