Protein coding transcript 221867

• Transcript: Ll_transcript_9519
• CDS coordinates: 2420-3559 (+)
• Peptide sequence: MSLSDAIPRTFDSQMHSGEFEALDRRPYSDVEDKGTNNDEELPSLELSLKRLRGVKDAGNIQDERNVLRRSDLSAFSRYNAASNAKKSPTGYVGSNSPHNNSLEVTKKDLSRDIQSNSSGNPPNQNSNGASNNIDMGSTTDNNAFTKSAVIRAPAVVSTTKCLYQSSAFQPLKNNLMCTSQQVVLHDTEDKTAPTLAPPRVDVHKDSATKDFCHHYESHNCLANNMQHQLPPDHRAELFKKMAATAPNFGSSNVVEVAVEGNVGNYSVNRSASGSNNGSNGQNGCGTDFNVGGTNIENNNGFAVNSGSGDGSANRVDQNKISQREAALTKFREKRKERCFHKKVRYQSRKKLAEQRPRFRGQFVRQSSTGSASEATDNS*
• ORF Type: complete

Annotations of Ll_transcript_9519

• Blastp: Two-component response regulator-like PRR73 from Oryza sativa with 43.23% of identity
• Blastx: Two-component response regulator-like APRR7 from Arabidopsis with 61.42% of identity
• Eggnog: Transcription factor(COG5641)
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000796)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427737.1)
• Pfam: CCT motif (PF06203.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;