Protein coding transcript 221870

• Transcript: Ll_transcript_9548
• CDS coordinates: 1-297 (+)
• Peptide sequence: PVGNRPGGYQHGSGSKNKATGRVWVMHYPDPTRPIAISTLVKAANIIEAANGLQAWKMLEDLTNHIDLILTEVAMPGLSGIGLLYKIMSHKTRKNIPVI
• ORF Type: internal

Annotations of Ll_transcript_9548

• Blastp: Two-component response regulator-like APRR7 from Arabidopsis with 58.02% of identity
• Blastx: Two-component response regulator-like APRR7 from Arabidopsis with 58.02% of identity
• Eggnog: Transcription factor(COG5641)
• Kegg: Link to kegg annotations (AT5G02810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427742.1)
• Pfam: Response regulator receiver domain (PF00072.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;