Protein coding transcript 22188

• Transcript: Ll_transcript_319157
• CDS coordinates: 25-936 (+)
• Peptide sequence: MGESLSGATLIHNPTPKVENDMMSIFDKHLLQNISELPQQFQWPSEQLVETSHESLNEPLIDLGVLKTGDEVAIAKAAELVRNACMKHGVFQVINHGVDLDLIKSAYEEMDTIFNLPMSQKLSVKKKEGSQEGYSGGHGDRFSSRLPWKEILTFINDYNKVSSDSQVLDYFVSNFGPQFQHTGLVFQKYCEALKEISHSVMELLAISLGVDRMHYKEFFDDGYLVMRVNSYPPCLDSAHTFGTGPHTDPTSLTFLHQDQVGGLEVFSDNKWLQVRPRPDAFVINIGDTFTALTNGIYKSCLHR*
• ORF Type: complete

Annotations of Ll_transcript_319157

• Blastp: Gibberellin 20 oxidase 1-B from Triticum with 45.71% of identity
• Blastx: Gibberellin 20 oxidase 1-A from Triticum with 45.71% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458758.1)
• Pfam: non-haem dioxygenase in morphine synthesis N-terminal (PF14226.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;