Protein coding transcript 221883

• Transcript: Ll_transcript_8446
• CDS coordinates: 1892-2524 (+)
• Peptide sequence: MSKVEQPSCTTVTTTTTTMKEEESSFHNQFQTSSPVSVLDSSSSYSGGKTIPRSSPEIYIPVPCGRARSKRPRPAAFNPHPAMHLISPASSSVGENMQPNVVSTKASSDSENFAESQPVTKMLKHCSGEHKKRKKIKLSLPSPPPADDTNQNGSQAVRKCMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFCASVH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_8446

• Blastp: GATA transcription factor 8 from Arabidopsis with 87.27% of identity
• Blastx: GATA transcription factor 8 from Arabidopsis with 87.27% of identity
• Eggnog: Transcription factor(COG5641)
• Kegg: Link to kegg annotations (AT3G54810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434043.1)
• Pfam: GATA zinc finger (PF00320.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;