Protein coding transcript 22191

• Transcript: Ll_transcript_319160
• CDS coordinates: 25-969 (+)
• Peptide sequence: MGESLSGATLIHNPTPKVENDMMSIFDKHLLQNISELPQQFQWPSEQLVETSHESLNEPLIDLGVLKTGDEVAIAKAAELVRNACMKHGVFQVINHGVDLDLIKSAYEEMDTIFNLPMSQKLSVKKKEGSQEGYSGGHGDRFSSRLPWKEILTFINDYNKVSSDSQVLDYFVSNFGPQFQHTGLVFQKYCEALKEISHSVMELLAISLGVDRMHYKEFFDDGYLVMRVNSYPPCLDSAHTFGTGPHTDPTSLTFLHQDQVGGLEVFSDNKWLQVRPRPDAFVINIGDTFTVCILPTGIVCYRFSLSMGPRSISI*
• ORF Type: complete

Annotations of Ll_transcript_319160

• Blastp: Gibberellin 20 oxidase 1-B from Triticum with 43.98% of identity
• Blastx: Gibberellin 20 oxidase 1-B from Triticum with 43.98% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458758.1)
• Pfam: non-haem dioxygenase in morphine synthesis N-terminal (PF14226.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;