Protein coding transcript 221945

• Transcript: Ll_transcript_8971
• CDS coordinates: 2-1051 (+)
• Peptide sequence: TKALQFIEEMTRNTDSVQERVLAEILSQNAETEYLKRFGLNGATDRDTFKTKIPVVNYEDLQPDIERIANGDTSPIFSSHPISEFLTSSGTSAGERKLMPTILQELDRRTLLYSLLMPVMNQYVRDLDKGKGLYFLFIKAETKTPSGLVARPVLTSYYKSEHFKNRPTDPYNIYTSPNETILCTDSFQSMYSQMLCGLIMRHQVLRVGAVFASGLLRSIRFLQLNWRDLAHDISTGTLNPKITDPSIKECMGNILKPEPELADFIRNECSGDNWECIITRIWPNTKYIDVIVTGAMAQYIPTIDYYSGGLPKPCTMYASSECYFGLNLKPICDPSEVSYTIMPNMGYFEF
• ORF Type: internal

Annotations of Ll_transcript_8971

• Blastp: Probable indole-3-acetic acid-amido synthetase GH3.1 from Arabidopsis with 78.86% of identity
• Blastx: Probable indole-3-acetic acid-amido synthetase GH3.1 from Arabidopsis with 78.86% of identity
• Eggnog: Indole-3-acetic acid-amido synthetase(ENOG410XQH0)
• Kegg: Link to kegg annotations (AT2G14960)
• CantataDB: Link to cantataDB annotations (CNT0000543)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420537.1)
• Pfam: GH3 auxin-responsive promoter (PF03321.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;