Transcript | Ll_transcript_8972 |
---|---|
CDS coordinates | 199-1545 (+) |
Peptide sequence | MGKGLYFYFIKAETKTVGGLVARPVLTSYYKSEAFKNRPYDPYSIYTSPDEAILCTDSFQSMYTQMLCGLIMRHQVLRVGAVFASGLLRAIRFLQLNWHHLAHDISTGTLNPKITDPSIKECMSKILKPDPELADFVTKECCGENWEGIITRIWPNTKYLDVIVTGAMAQYIPTLDYYSGGLLPLACTMYASSECYFGLNLNPICKPSEVCYTIMPNMGYFEFLPHGSNDSNDLVELADVEVGKYYELVITTYAGLCRYRVGDILQVTSFHNKAPQFRFVRRKNVLLSIDSDKTDEAELQKAIENALNLLKEFNTTVVEYTSFADTQSIPGHYVIYWELLMKDNSNAPTNEVLEKCCLTMEESLNSVYRQGRVADNSIGPLEIRVVKNGTFEELMDYAISRGASINQYKVPRCVSFTPIMELLDSRVVSVHFSPATPHWTPERRRFEG* |
ORF Type | complete |
Blastp | Indole-3-acetic acid-amido synthetase GH3.3 from Arabidopsis with 79.24% of identity |
---|---|
Blastx | Indole-3-acetic acid-amido synthetase GH3.3 from Arabidopsis with 77.63% of identity |
Eggnog | Indole-3-acetic acid-amido synthetase(ENOG410XQH0) |
Kegg | Link to kegg annotations (AT2G23170) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446833.1) |
Pfam | GH3 auxin-responsive promoter (PF03321.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer