Protein coding transcript 222

• Transcript: Ll_transcript_352612
• CDS coordinates: 134-937 (+)
• Peptide sequence: MASYGREGVVRQYVRSKVPRLRWTPELHRCFVYAIQILGGHHKATPKLVLQLMDIKGLTISHVKSHLQMYRSMRSDSCKQDRVSSQHRKQSFLEHDDDDGWVDEVNDVGVNSCFKRARTESNQHTFYDYLRLKVEEKGIREIFGDSVRKSHARTSAVIPYCDENLNSLKCTKQGSELLKVTKLNDTNPLNIHDNIKRVHAEYDDVEGHKLSLSISLPQRPSQKSNASSGSEAIISSCPGSSNYKGCFSSSTVQNIINLDLSLAICGN*
• ORF Type: complete

Annotations of Ll_transcript_352612

• Blastp: Putative Myb family transcription factor At1g14600 from Arabidopsis with 77.61% of identity
• Blastx: Putative Myb family transcription factor At1g14600 from Arabidopsis with 75.71% of identity
• Eggnog: Transcription factor(ENOG410YDJI)
• Kegg: Link to kegg annotations (AT1G14600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460447.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;