Transcript | Ll_transcript_11314 |
---|---|
CDS coordinates | 134-586 (+) |
Peptide sequence | MLKPSFHYLNSLPSSHSSTSNLISIRFRRTAKISMSMSTSHDTVPPENRVVVGFGMTTVDFLATVDGFPNPDDKVRTTSFKVQGGGNAGNAITCAARLGLKPKLISKVADDSQGTDILNELQADGVDTSFIVVSKGGSSTFSYVLIDNQT* |
ORF Type | complete |
Blastp | Ribokinase from Bacillus with 38.55% of identity |
---|---|
Blastx | Ribokinase from Bacillus with 38.55% of identity |
Eggnog | pfkb domain protein(COG0524) |
Kegg | Link to kegg annotations (BSU35920) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444452.1) |
Pfam | pfkB family carbohydrate kinase (PF00294.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer