Protein coding transcript 222047

• Transcript: Ll_transcript_11283
• CDS coordinates: 79-468 (+)
• Peptide sequence: MFIGPINVRASKKDVQLKVKEEYNSYRDKTALLFLLFPAILLILRSWVWDGCLPAFPVQIYQAWLLFLYAGLAFRENILRVNGSDIRPWWIYHHYCAMIMALVSLTWEIKGQPDCENNQIGVQLFLQWAM
• ORF Type: 3prime_partial

Annotations of Ll_transcript_11283

• Blastp: Transmembrane protein 120 homolog from Dictyostelium with 36.61% of identity
• Blastx: Transmembrane protein 120 homolog from Dictyostelium with 39.81% of identity
• Eggnog: Transmembrane protein 120B(ENOG410XT6G)
• Kegg: Link to kegg annotations (DDB_G0288699)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427661.1)
• Pfam: TMPIT-like protein (PF07851.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;