Protein coding transcript 222052

• Transcript: Ll_transcript_11269
• CDS coordinates: 1563-2024 (+)
• Peptide sequence: MVMALVSITWEIKGQPDCENNQIGVQLFLQWAMMQGVAMLLQNRYQRQRLYTRIALGKAKRMDVVWGETAGVDGQVWLLCPILFILQGFEAYVGLLLLQTAFVGVFYEWQVIFCGVLLILMAVGNFINTVQTLMVKSRFKAKMIKSKSKQRLN*
• ORF Type: complete

Annotations of Ll_transcript_11269

• Blastp: Transmembrane protein 120 homolog from Sophophora with 30.53% of identity
• Blastx: Transmembrane protein 120B from Bos with 28.66% of identity
• Eggnog: Transmembrane protein 120B(ENOG410XT6G)
• Kegg: Link to kegg annotations (Dmel_CG32795)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427661.1)
• Pfam: TMPIT-like protein (PF07851.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;