Protein coding transcript 222092

• Transcript: Ll_transcript_10996
• CDS coordinates: 669-1217 (+)
• Peptide sequence: MKAVGKRSLEWDLNDWKWDGDLFTAKQLNSAPSDCRNQKLFPSDPENPAYGDSSNNLSLCWDGINPVERNRELEKRKSGGDIVAEGVEMSDDVGSLNLNLGAQVYPIMEGEETIGKKTKITGTTSASNRAVCQVEDCRADLSIAKDYHRRHKVCELHSKASKALVGNVMQRFCQQCSRSVRL*
• ORF Type: complete

Annotations of Ll_transcript_10996

• Blastp: Squamosa promoter-binding-like protein 12 from Arabidopsis with 46.96% of identity
• Blastx: Squamosa promoter-binding-like protein 12 from Arabidopsis with 38.32% of identity
• Eggnog: Squamosa promoter-binding-like protein(ENOG4110DQF)
• Kegg: Link to kegg annotations (AT3G60030)
• CantataDB: Link to cantataDB annotations (CNT0001755)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414799.1)
• Pfam: SBP domain (PF03110.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;