Protein coding transcript 222093

• Transcript: Ll_transcript_10997
• CDS coordinates: 186-992 (+)
• Peptide sequence: MKAVGKRSLEWDLNDWKWDGDLFTAKQLNSAPSDCRNQKLFPSDPENPAYGDSSNNLSLCWDGINPVERNRELEKRKSGGDIVAEGVEMSDDVGSLNLNLGAQVYPIMEGEETIGKKTKITGTTSASNRAVCQVEDCRADLSIAKDYHRRHKVCELHSKASKALVGNVMQRFCQQCSRFHILQEFDEGKRSCRKRLAGHNKRRRKTHPDPIVANGGLLNGERGSGYMLTSLLRILSDMHNYAFYKLQQIAQVLQETQMFSLICCGTWQV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_10997

• Blastp: Squamosa promoter-binding-like protein 12 from Arabidopsis with 51.03% of identity
• Blastx: Squamosa promoter-binding-like protein 12 from Arabidopsis with 48.56% of identity
• Eggnog: Squamosa promoter-binding-like protein(ENOG4110DQF)
• Kegg: Link to kegg annotations (AT3G60030)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014623368.1)
• Pfam: SBP domain (PF03110.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;