Protein coding transcript 222123

• Transcript: Ll_transcript_11033
• CDS coordinates: 523-1344 (+)
• Peptide sequence: MDAEFVEKNQFLNGHVVQEMNGKKSLEWDLNDWKWDGDLFTAMSLNSVPSDCRSHQFFPPHPENAANASYNNLSSSINSSKGKRELEKRTREVLIGEEGKEMLNDEGGSLNLKLGGQVYPIMEESEEKSGKKTKVIVGSIPTTTTTSNRAVCQVQDCRADLSNAKDYHRRHKVCDLHSKASKALVANVMQRFCQQCSRFHVIQEFDEGKRSCRRRLAGHNRRRRKTHPDVTAVNGGSLNDESGSSYLLMSLIQILSNMHYYAFYKLQQMAQIK*
• ORF Type: complete

Annotations of Ll_transcript_11033

• Blastp: Squamosa promoter-binding-like protein 12 from Arabidopsis with 45.45% of identity
• Blastx: Squamosa promoter-binding-like protein 6 from Oryza sativa with 37.85% of identity
• Eggnog: Squamosa promoter-binding-like protein(ENOG4110DQF)
• Kegg: Link to kegg annotations (AT3G60030)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455838.1)
• Pfam: SBP domain (PF03110.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;