Protein coding transcript 222157

• Transcript: Ll_transcript_11470
• CDS coordinates: 67-735 (+)
• Peptide sequence: MATALLKKAVNRIPSSPSWKLSLLRAHASEAQAQQVEPKARATSTPKTFQIYRWSPDSPSKPELKSYEINLKDCGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGCNGLACLTKIPAAAEATTVTPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPENEGKEILQSKKDRAKLDGMYECILCACCSTSCPSYWWNPESYLGPAALLHANR*
• ORF Type: complete

Annotations of Ll_transcript_11470

• Blastp: Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial from Arabidopsis with 74.11% of identity
• Blastx: Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial from Arabidopsis with 74.11% of identity
• Eggnog: succinate dehydrogenase(COG0479)
• Kegg: Link to kegg annotations (AT5G40650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447431.1)
• Pfam: 2Fe-2S iron-sulfur cluster binding domain (PF13085.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;