Transcript | Ll_transcript_9709 |
---|---|
CDS coordinates | 1617-1928 (+) |
Peptide sequence | MIDGLGRSCLRLQNIHIASMRLSHAVVLALSAAQLRELQMLSLVLGSEITDASVAAIASSYPNLELLDLSGSGISDSGIGIICNAFPETLSRLLIALCPNVTSS |
ORF Type | 3prime_partial |
Blastp | F-box/LRR-repeat protein 17 from Arabidopsis with 71.15% of identity |
---|---|
Blastx | F-box/LRR-repeat protein 17 from Arabidopsis with 51.82% of identity |
Eggnog | F-box LRR-repeat protein(ENOG410YEIX) |
Kegg | Link to kegg annotations (AT3G54650) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019451174.1) |
Pfam | Leucine Rich repeat (PF13516.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer