Protein coding transcript 222168

• Transcript: Ll_transcript_9720
• CDS coordinates: 52-696 (+)
• Peptide sequence: MESDFDSTMLACIAFSCPNLEHMEVSTFDTAINRINGDELGRFVADKRSLKSLKMEGCSNLGGFVLCSSSLCTLWLSDLYCLSKMVFNCPQLREISLEFSCQENDDTDLTAMIDGLGRSCLRLQNIHIASMRLSHAVVLALSAAQLRELQMLSLVLGSEITDASVAAIASSYPNLELLDLSGSGISDSGIGIICNAFPETLSRLLIALCPNVTSS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_9720

• Blastp: F-box/LRR-repeat protein 17 from Arabidopsis with 72.56% of identity
• Blastx: F-box/LRR-repeat protein 17 from Arabidopsis with 71.12% of identity
• Eggnog: F-box LRR-repeat protein(ENOG410YEIX)
• Kegg: Link to kegg annotations (AT3G54650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441910.1)
• Pfam: Leucine Rich repeat (PF13516.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;