Transcript | Ll_transcript_9721 |
---|---|
CDS coordinates | 3-440 (+) |
Peptide sequence | TLSRLLLSLCPNVTSSGIQFATAQLPLLELMDCGMTICDPNSQDPTTDENNGKLQKTTGTNLHLINQKLIIKHGRLRKLSLWGCSGLDALYLNCPQLNDLNLNSCRNLHPERLLLHCPALGNVHASGCQDMLIGAIQSQVCNAFTA |
ORF Type | internal |
Blastp | F-box/LRR-repeat protein 17 from Arabidopsis with 67.12% of identity |
---|---|
Blastx | F-box/LRR-repeat protein 17 from Arabidopsis with 67.12% of identity |
Eggnog | F-box LRR-repeat protein(ENOG410YEIX) |
Kegg | Link to kegg annotations (AT3G54650) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441910.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer