Protein coding transcript 222169

• Transcript: Ll_transcript_9721
• CDS coordinates: 3-440 (+)
• Peptide sequence: TLSRLLLSLCPNVTSSGIQFATAQLPLLELMDCGMTICDPNSQDPTTDENNGKLQKTTGTNLHLINQKLIIKHGRLRKLSLWGCSGLDALYLNCPQLNDLNLNSCRNLHPERLLLHCPALGNVHASGCQDMLIGAIQSQVCNAFTA
• ORF Type: internal

Annotations of Ll_transcript_9721

• Blastp: F-box/LRR-repeat protein 17 from Arabidopsis with 67.12% of identity
• Blastx: F-box/LRR-repeat protein 17 from Arabidopsis with 67.12% of identity
• Eggnog: F-box LRR-repeat protein(ENOG410YEIX)
• Kegg: Link to kegg annotations (AT3G54650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441910.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;