Protein coding transcript 222172

• Transcript: Ll_transcript_9710
• CDS coordinates: 3-1124 (+)
• Peptide sequence: FPSLTMQHSHPNSAAVSPAPHSTVASSSDTKRGKKRGNYNCSRCGQPKKGHNCNIKTPTSATITPADPSLTAVSVISAPTLLPVPRQAPSHLRRALSFDDFDDRTGGIDIDPQERDEMADEDSATDLLDLDLDSCGLPANLMWDILRRLPPAELLSAAKVCKGWRETARRLWKAAEELKVRVPASVHVGFVASMLQKCPGILRLSLRMESDFDSTMLACIAFSCPNLEHMEVSTFDNAMNRINGDELGRFVADKKRLKSLKMEGCSNLGGFVLCSSSLCTLWLSDLYCLSKMVFNCPQLREISLEFSRQENDGTDLTTMIDGLGRSCLRLQNLHIASMQLSHAAVLALSAAQLRFIFLAVSLSLFSSYLRLLT*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_9710

• Blastp: F-box/LRR-repeat protein 17 from Arabidopsis with 54.35% of identity
• Blastx: F-box/LRR-repeat protein 17 from Arabidopsis with 54.2% of identity
• Eggnog: F-box LRR-repeat protein(ENOG410YEIX)
• Kegg: Link to kegg annotations (AT3G54650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426533.1)
• Pfam: F-box-like (PF12937.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;