| Transcript | Ll_transcript_9712 |
|---|---|
| CDS coordinates | 147-494 (+) |
| Peptide sequence | MDCGMTICDPNSQDPTTDENNGKLQKTTGTNLHLINQKLIIKHGRLRKLSLWGCSGLDALYLNCPQLNDLNLNSCRNLHPERLLLHCPALGNVHASGCQDMLIGAIQSQVCNAFTA |
| ORF Type | 3prime_partial |
| Blastp | F-box/LRR-repeat protein 17 from Arabidopsis with 62.07% of identity |
|---|---|
| Blastx | F-box/LRR-repeat protein 17 from Arabidopsis with 65.65% of identity |
| Eggnog | F-box LRR-repeat protein(ENOG410YEIX) |
| Kegg | Link to kegg annotations (AT3G54650) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019441910.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer