Protein coding transcript 222175

• Transcript: Ll_transcript_9714
• CDS coordinates: 1158-2312 (+)
• Peptide sequence: MLACIAFSCPNLEHLEVTTFCTSVNRINGDELGRFIADKKSLKTLKMEGCSNLGGFVLCSSSLCTLWLSDLQYLSKMVFNCPQLREISLEFSQQENDATDLIAMIENLGRSCLRLQNIHVASIRLSHAVVLALSTAQFRELRMLSLVLGSEITDASVAAIASSYPNLELLDLSGSGISDSGIGMICNVFSETLSRLLLALCPNVTSSGIQFATAQLPLLELMDCGMTICDHNSEDPSSGENNCKLEKVSNANLHPVNQKLIIKHGRLRKLSLWGCSGLDALYLNCPQLNDLNLNSCRNLHPERLLLQCPALENVHASGCQDMLIGAIQSQICTAFTNMDNHSPSKHLPDGSKRVRVPHLLSGEFHEPDKKRRRIEGRLCNVLLE*
• ORF Type: complete

Annotations of Ll_transcript_9714

• Blastp: F-box/LRR-repeat protein 17 from Arabidopsis with 64.06% of identity
• Blastx: F-box/LRR-repeat protein 17 from Arabidopsis with 63.85% of identity
• Eggnog: F-box LRR-repeat protein(ENOG410YEIX)
• Kegg: Link to kegg annotations (AT3G54650)
• CantataDB: Link to cantataDB annotations (CNT0001135)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451174.1)
• Pfam: Leucine Rich repeat (PF13516.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;