Protein coding transcript 222179

• Transcript: Ll_transcript_9719
• CDS coordinates: 104-1360 (+)
• Peptide sequence: MQRHHPNSAAVSPAAHSAVASSSDSKRGKRRGSYNCGRCGQPKKGHNCNIKTPTNAKVTPLDPSLTAVSVVSSRTPLPVARHAPSHPRRALSFDDFDDRTGGIDFDPAECDEMGDRDYVEESLDPLDLDIDSCGLPVNLLWEVMRRLPPAGLLSAAKVCKGWRETARRLWKAAEELKLRVPSSVHVGFVASMLQKCPGILRLSLRMESDIDSTMLACIAFSCPNLEHLEVTTFCTSVNRINGDELGRFIADKKSLKTLKMEGCSNLGGFVLCSSSLCTLWLSDLQYLSKMVFNCPQLREISLEFSQQENDATDLIAMIENLGRSCLRLQNIHVASIRLSHAVVLALSTAQFRELRMLSLVLGSEITDASVAAIASSYPNLELLDLSGYISVPILIALECLLGTLKIYLPQYRKIKYEN*
• ORF Type: complete

Annotations of Ll_transcript_9719

• Blastp: F-box/LRR-repeat protein 17 from Arabidopsis with 58.72% of identity
• Blastx: F-box/LRR-repeat protein 17 from Arabidopsis with 60% of identity
• Eggnog: F-box LRR-repeat protein(ENOG410YEIX)
• Kegg: Link to kegg annotations (AT3G54650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451174.1)
• Pfam: F-box domain (PF00646.32)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;