Protein coding transcript 222268

• Transcript: Ll_transcript_8656
• CDS coordinates: 641-1159 (+)
• Peptide sequence: MNERVRRACANSCADFVYGFLETSAKKGSEYWLVWRFEGDATLADLVQSRDFPYNVETLILGEIQDLPKGLERENRIIQTIMRQLLFALDSLHSTGIVHRDIKPQNIIFSEGSRTFKIIDLGAAADLRVGINYIPKEFLLDPRYLLTEMFPLQLDIRKLNFTSKLKCPYHSY*
• ORF Type: complete

Annotations of Ll_transcript_8656

• Blastp: Serine/threonine-protein kinase STN7, chloroplastic from Arabidopsis with 82% of identity
• Blastx: Serine/threonine-protein kinase STN7, chloroplastic from Arabidopsis with 78.79% of identity
• Eggnog: Cyclin-Dependent Kinase(ENOG410XPP3)
• Kegg: Link to kegg annotations (AT1G68830)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429954.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;