Protein coding transcript 22228

• Transcript: Ll_transcript_318742
• CDS coordinates: 2-721 (+)
• Peptide sequence: ASISKVSTPIPLSASLSQSLRPQKCFFISFQPSINSKPYHLSSSPHPLKPSLRVKCSQTGGNGIAAKRTVLHDLYEKEGQSPWYDNLCRPVTDLLPLIASGVRGVTSNPAIFQKAISSSDAYNDQFRELVQAGKDIESAYWELVVKDIQDASKLFELIYDQTDGADGYVSVEVSPRLADDTEGTVEAAKWLHKVVSRPNVYIKIPATAACVPSIKEVIANGISVNVTVSLSCITTFFHLT
• ORF Type: internal

Annotations of Ll_transcript_318742

• Blastp: Transaldolase 2 from Streptomyces with 47.5% of identity
• Blastx: Transaldolase 2 from Streptomyces with 47.5% of identity
• Eggnog: Transaldolase is important for the balance of metabolites in the pentose-phosphate pathway (By similarity)(COG0176)
• Kegg: Link to kegg annotations (SAV_6314)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429562.1)
• Pfam: Transaldolase/Fructose-6-phosphate aldolase (PF00923.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;