Protein coding transcript 222305

• Transcript: Ll_transcript_9732
• CDS coordinates: 3-308 (+)
• Peptide sequence: MLLHRYSLNRTADFETVREIKEKLCYISYDYKREYQLGLETTILVNNYTLPDGTVIKVGTERFQAPEALFTPELIDVEGDGMADMVFRCIQEMDIDNRMSV*
• ORF Type: complete

Annotations of Ll_transcript_9732

• Blastp: Actin-related protein 2 from Arabidopsis with 93.62% of identity
• Blastx: Actin-related protein 2 from Arabidopsis with 91% of identity
• Eggnog: Actin-related protein(COG5277)
• Kegg: Link to kegg annotations (AT3G27000)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416809.1)
• Pfam: Actin (PF00022.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;