Protein coding transcript 222354

• Transcript: Ll_transcript_10290
• CDS coordinates: 97-1230 (+)
• Peptide sequence: MAPQSPKLVVTIDLSKKPWEQNLPLHNRWHPQIPPVADVNTGQVFRVEMVDWTGGTIKDDNSALDIKHIDLSTVHYLSGPIRVMDSDGILAKPGDLLVVEICNLGPLPGDEWGYTGTFDRENGGGFLTDHFPCATKAIWHFEGIYAHSPQIPGVRFPGLTHPGIIGTAPSMELLNIWNEREKDVEENGIESFKLCEVLHSRPLANLPSTNGCHLGKIQKGTAEWEKIAKEAARTIPGRENGGNCDIKNLSRGSKIYLPVFVEGANLSTGDMHFSQGDGEVSFCGAIEMSGFLELKCEIIRGGMKEYLTPMGPTPLHVNPIFEIGPVEPRFSEWLVFEGISVDESGRQHYLDASVAYKRAVLNAIDYLSKFGYSKEQV*
• ORF Type: complete

Annotations of Ll_transcript_10290

• Blastp: Formamidase from Methylophilus with 50.13% of identity
• Blastx: Formamidase from Methylophilus with 50.13% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000428)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423857.1)
• Pfam: Acetamidase/Formamidase family (PF03069.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;