| Transcript | Ll_transcript_10311 |
|---|---|
| CDS coordinates | 1041-1364 (+) |
| Peptide sequence | MHFSQGDGEVSFCGAIEMSGFLELKCEIIRGGMKEYLTPMGPTPLHVNPIFEIGPVEPRFSEWLVFEGISVDESGRQHYLDASVAYKRAVLNAIDYLSKFGYSKEQV* |
| ORF Type | complete |
| Blastp | Formamidase from Methylophilus with 53.27% of identity |
|---|---|
| Blastx | Formamidase from Methylophilus with 55.78% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019423858.1) |
| Pfam | Acetamidase/Formamidase family (PF03069.14) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer