Protein coding transcript 222363

• Transcript: Ll_transcript_10299
• CDS coordinates: 1041-1589 (+)
• Peptide sequence: MHFSQGDGEVSFCGAIEMSGFLELKCEIIRGGMKEYLTPMGPTPLHVNPIFEIGPVEPRFSEWLVFEGISVDESGRQHYLDASVAYKRAVLNAIDYLSKFGYSKEQVYLLLSCCPCEGRISGIVDAPNAVATLAIPIAIFDQDIRPKNNKVPVGPRLIKKPDVLKCTYDGNLPITRNPSATQ*
• ORF Type: complete

Annotations of Ll_transcript_10299

• Blastp: Formamidase from Methylophilus with 52.15% of identity
• Blastx: Formamidase from Methylophilus with 53.92% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424281.1)
• Pfam: Acetamidase/Formamidase family (PF03069.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;