Protein coding transcript 222478

• Transcript: Ll_transcript_11523
• CDS coordinates: 81-386 (+)
• Peptide sequence: MASVAGASAARSILRSCSTRRAAFRLGSEAKSTHSPFRMASNKPLSQSMLRCRVESSFCVESMLPYHMATASALMTSMLSVSCGSYGWLSEGIIFATMSLQ*
• ORF Type: complete

Annotations of Ll_transcript_11523

• Blastp: Protein NUCLEAR FUSION DEFECTIVE 6, chloroplastic/mitochondrial from Arabidopsis with 55.32% of identity
• Blastx: Protein NUCLEAR FUSION DEFECTIVE 6, chloroplastic/mitochondrial from Arabidopsis with 55.32% of identity
• Eggnog: NA(ENOG410ZH16)
• Kegg: Link to kegg annotations (AT2G20585)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426363.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;