Protein coding transcript 222500

• Transcript: Ll_transcript_9099
• CDS coordinates: 319-834 (+)
• Peptide sequence: MGTNAFLYMNLCQWDHWKITFTARPLFNDRRKFSKLADPKLKGRFPMRGLYQALAVASMCIQESAATRPLIGDVVTALSYLANQAYDTKGSGGDDKRNKDDKGGQILKDDEAGGSGRRLDLEGSEKDESPRETARMSDRERAVAEAKLWGENLREKRRQNVLKGSFDGSNA*
• ORF Type: complete

Annotations of Ll_transcript_9099

• Blastp: Serine/threonine-protein kinase PBS1 from Arabidopsis with 67.95% of identity
• Blastx: Serine/threonine-protein kinase PBL27 from Arabidopsis with 85.12% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G13160)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418628.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;