Transcript | Ll_transcript_9099 |
---|---|
CDS coordinates | 319-834 (+) |
Peptide sequence | MGTNAFLYMNLCQWDHWKITFTARPLFNDRRKFSKLADPKLKGRFPMRGLYQALAVASMCIQESAATRPLIGDVVTALSYLANQAYDTKGSGGDDKRNKDDKGGQILKDDEAGGSGRRLDLEGSEKDESPRETARMSDRERAVAEAKLWGENLREKRRQNVLKGSFDGSNA* |
ORF Type | complete |
Blastp | Serine/threonine-protein kinase PBS1 from Arabidopsis with 67.95% of identity |
---|---|
Blastx | Serine/threonine-protein kinase PBL27 from Arabidopsis with 85.12% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT5G13160) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418628.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer