Transcript | Ll_transcript_427099 |
---|---|
CDS coordinates | 3-452 (+) |
Peptide sequence | SGHDGMSITSVLPFHDSNFDQTQPQAMNKTTLTNLRSNSFNENLLRGIKNQPLKCSSGRRKLFKGVRQRQWGKWVAEIRLPRNRKRVWLGTFDTAEEAAIAYDTAAYILRGEYAQLNFPDMKHVIQANSLNGTTAALVEAKLQAISVQSD |
ORF Type | internal |
Blastp | Ethylene-responsive transcription factor ERF062 from Arabidopsis with 54.68% of identity |
---|---|
Blastx | Ethylene-responsive transcription factor ERF062 from Arabidopsis with 54.68% of identity |
Eggnog | Transcription factor(ENOG410YPFQ) |
Kegg | Link to kegg annotations (AT4G13620) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427381.1) |
Pfam | AP2 domain (PF00847.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer