Protein coding transcript 2226

• Transcript: Ll_transcript_427099
• CDS coordinates: 3-452 (+)
• Peptide sequence: SGHDGMSITSVLPFHDSNFDQTQPQAMNKTTLTNLRSNSFNENLLRGIKNQPLKCSSGRRKLFKGVRQRQWGKWVAEIRLPRNRKRVWLGTFDTAEEAAIAYDTAAYILRGEYAQLNFPDMKHVIQANSLNGTTAALVEAKLQAISVQSD
• ORF Type: internal

Annotations of Ll_transcript_427099

• Blastp: Ethylene-responsive transcription factor ERF062 from Arabidopsis with 54.68% of identity
• Blastx: Ethylene-responsive transcription factor ERF062 from Arabidopsis with 54.68% of identity
• Eggnog: Transcription factor(ENOG410YPFQ)
• Kegg: Link to kegg annotations (AT4G13620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427381.1)
• Pfam: AP2 domain (PF00847.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;