Transcript | Ll_transcript_10406 |
---|---|
CDS coordinates | 1047-2462 (+) |
Peptide sequence | MLKLANGKGLSRRERQQLTRTTADIFRLVPFAVFIIVPFMEFLLPVFLKLFPNMLPSTFQDKMKEQEALKRRLNARIEYAKFLQETVKEMAKEIQNSRSGELKKTAEDLDEFMNKVRTGARVSNDEILGFAKLFNDELTLDNISRPRLVNMCKYMGISPYGTDAYLRYMLRKRLQEIKNDDKMIQAEGLKSLSEAELRQACRDRGLLGLLSVEEMRQQLKDWLDLSLSYSVPSSLLILSRAFSVSGKVRPEEAVQATLSSLPDEVVDTVGVTTLPSEDSVSERKRKLEFLEMQEERIKEEEEKEEEEQAKVSKSIGTEMDLAMEETTISTTKQTEEEAKTKAWEKREQLCELSRALAVLASASSVSNEREEFLRLVRKEIELYNSMVSKEGNEGELEAKEAYKAARKDSDSALEAAVSDKVSSALADRVDAMLQTLEKEIDDVDAKIGDRWRLLDRFLHNCCFLYANYDIF* |
ORF Type | complete |
Blastp | Mitochondrial proton/calcium exchanger protein from Gallus with 48.06% of identity |
---|---|
Blastx | Mitochondrial proton/calcium exchanger protein from Gallus with 48.43% of identity |
Eggnog | Leucine zipper-ef-hand containing transmembrane protein(ENOG410XRSP) |
Kegg | Link to kegg annotations (422898) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449919.1) |
Pfam | LETM1-like protein (PF07766.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer