Protein coding transcript 222612

• Transcript: Ll_transcript_10419
• CDS coordinates: 975-1481 (+)
• Peptide sequence: MIECYNYLFYFVQISLLVFCMKIIYFKLPLQNTRETAFSIRKLPLVKAKRYLEDVLAHKQAIPFRRFCRGVGRTAQAKNRHSNGQGRWPVKSAKFILDLLKNAESNAEVKGLDIDALYISHIQVNQAQRQRRRTYRAHGRINPYMSSPCHIELTLSEKEEPVKKEVNV*
• ORF Type: complete

Annotations of Ll_transcript_10419

• Blastp: 60S ribosomal protein L17 from Zea with 84.51% of identity
• Blastx: 60S ribosomal protein L17-2 from Arabidopsis with 84.62% of identity
• Eggnog: The globular domain of the protein is located near the polypeptide exit tunnel on the outside of the subunit, while an extended beta-hairpin is found that lines the wall of the exit tunnel in the center of the 70S ribosome (By similarity)(COG0091)
• Kegg: Link to kegg annotations (541667)
• CantataDB: Link to cantataDB annotations (CNT0000618)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460299.1)
• Pfam: Ribosomal protein L22p/L17e (PF00237.18)
• Rfam: snoR74 (RF01231)
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;