Transcript | Ll_transcript_10435 |
---|---|
CDS coordinates | 495-1025 (+) |
Peptide sequence | MPLCYENAACKARGADLRVHFKNTRETAFSIRKLPLVKAKRYLEDVLAHKQAIPFRRFCRGVGRTAQAKNRHSNGQGRWPVKSAKFILDLLKNAESNAEVKGLDVDALYISHIQVNQAQRQRRRTYRAHGRINPYMSSPCHIELILSEKEEPVKKEPETQLATKKKSQALKSGASS* |
ORF Type | complete |
Blastp | 60S ribosomal protein L17-2 from Arabidopsis with 88.82% of identity |
---|---|
Blastx | 60S ribosomal protein L17-2 from Arabidopsis with 87.2% of identity |
Eggnog | The globular domain of the protein is located near the polypeptide exit tunnel on the outside of the subunit, while an extended beta-hairpin is found that lines the wall of the exit tunnel in the center of the 70S ribosome (By similarity)(COG0091) |
Kegg | Link to kegg annotations (AT1G67430) |
CantataDB | Link to cantataDB annotations (CNT0000618) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415876.1) |
Pfam | Ribosomal protein L22p/L17e (PF00237.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer